SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014293 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014293
Domain Number 1 Region: 971-1721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.47e-260
Family Motor proteins 0.000000000228
Further Details:      
 
Domain Number 2 Region: 2639-2722
Classification Level Classification E-value
Superfamily SH3-domain 0.000000106
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 3 Region: 3076-3185
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000366
Family Second domain of FERM 0.012
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014293
Domain Number - Region: 3186-3236
Classification Level Classification E-value
Superfamily PH domain-like 0.00334
Family Third domain of FERM 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014293   Gene: ENSFCAG00000015414   Transcript: ENSFCAT00000015418
Sequence length 3301
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:11178269:11228766:-1 gene:ENSFCAG00000015414 transcript:ENSFCAT00000015418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEDEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGL
HTGPQKTKRKKKARTVLKSTSKLMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPR
ARSLSKASTAINWLTKKFLIKKAEESGSEQATLDAWLNRSSSRIGSRKLPFPSGAEILRH
GGRLRRFPRSRSIYDSGEPVGFLPFEDEVPFRPSGSRKSLYGLEGFQDLGEYYDYHREGD
DYYDRQSLYQYEEEQEPYMGYGSYGPYGPAWPPYGDHAHGYPPEDPYDYYHPDYYGGPYY
PTYPYSYGYDDYEPPYAPPSGYASPYSYYDAYQGEAYPHGYYLDPYAPYEAPYPPYDRPY
DLPYDVPYFDPYGGPYGAPYGIPYGEGIYGGGDQAIYPPEVPYLYPEEPAFAYPWVPPPI
LSPHNPYAHPMDDIAELEEPEEAGAERQTTSFRLPSAAFFEQQGMDKPARSKLSLIRRFR
LFPRPQVKLFGKEKLDVSLPPSLDIPLPLGDADEDEEEEEMPPVPPVPYAHPFWGFLTPR
QRNLQRALSAFGAHRGLGFGTDFGRSPPRPATSLARFLKKTLSEKKPIPRLRSSQKARLG
GPAVREAAYKRFGYKLAGMDSPPLLGHSSRCRSLNLPSHLPNTWRRLSEPPTRAVKPRVR
QPFQRPPNAGSWPVAAAAPERRESQREPEDSETPWTVPPLAPSWDVDLPPAQRPPSPWPG
GAGSRRGFSRPPPVPENPFLQHVGPVPPPASQSEDPASADLTSVFLGRHHDPGPGQLVKS
ASPIPEKPEEETTPEGPQSPAEPERSTPTPPKDSAPERKTLRLSLSYPLATCDKMRATWP
PWRRWGTVPSAPAPLAPTGAPGPLPRVGERRQAGPGRFAVVMPQVQKLSAFQRVGPAPLQ
PPVQISRDPEPGPKPRAWNLLWSCFWLPAEAPRPWPRVLARPQSCRLGPGANCLHHGGPW
EEVGPKSWFNKMHSIRNLPTTRFRDQCREDGVEDMTQLEDLQETTVLSNLKTRFERNLIY
TYIGSILVSVNPYRMFGIYGQEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCII
ISGESGSGKTEATKLILRYLAAMNQKRGIMQQIKILEATPLLESFGNAKTVRNDNSSRFG
KFVEVFLEGGVISGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEA
ETYYYLNQGGNCEISGKSDSDDFRRLLAAMEVLGFSGEDQDSIFRILASILHLGNVYFEK
YETDAQETASVVSAREIQAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDAR
DAIAKVLYALLFGWLIARVNALVSPRQDTLSIAILDIYGFEDLSFNSFEQLCINYANENL
QYLFNKIVFQGLQEEYIREQIDWREITFADNQPCINLISLKPYGILRILDPLTLACPQAT
DHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLF
VRSRTRVVAHLFSSHAPQAAPQRLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPL
FVRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVAL
KHNLPASGDMCVSVLSRLCTVTPNMYRVGVSKLFLKEHLHQLLESMREHVLNLAAVTLQS
CLRGFFIRRRFRSLRRKIILLQSRARGYLARQRYQQMRRSLVKFRSLVHTYVNHRHYLKL
RAERRLRAEEARLREQEELSKREVVAVGHLEVPAELAGLLQAVAGLRPARVPRVVPVRTP
RLQTEPRVTLPLDINNYPMAKFVRCHFKEPAFGMLTVPLKTPLMRLPVECHAEAVSVFKL
ILRFMGDPHLYGAQENVFGNYIVQKGLAVPELRDEILAQLANQVWRNPSTHNAERGWLLL
ATCLSGFAPSSRLNKYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTFPPTQL
EWIATQEKASMALDVGCFNGDQFSCPVHSWSTGEEVAGDILRHRGLTDGWRGWTVAMKNG
VQWAELAGHDYVLDLVADLELLRDFPRQKSYFIVGAEGPVAGRGGPRAVFGNSWDSDSDT
PTRPEPQGHVPKVADSDGYCSHNEDVSGGEGSWGLYRTPDSDSLGEPSVPHKGLDCYLDS
LFDPVLSYGDADLEKPTAIAYRMKGGGRPGESGSSSTEDPPRRPPEPKPKPKPIPGLDAS
TLALQQAFIHKQAVLLAREMTLQAMALQQQPLSPAPRPLLPEKPLAPEARPKFVGTGPPA
KPVLLRSTPKPLAPAPLAKAPRAPTKPVAAPILAQDRACPETSSPCPELVRYSTLNSEHF
PQPTQQIKNIVRQYQHPPRGGRPEALRKDGGKVFVKRPDPHEEALMILKGQMGHPAAASG
SQVPREAVALVKPVTSTPRPSIGPTPVAPSRSLEPPEEPLQTRLHRLVNPNYYGYQDAPW
RIFLRKEVFYPKDSYSHPVQLDLLFRQIVHDTLSEACVRISEDERLKMKALFAQNQLDTQ
RPLATESVKRAVVSTARDSWEVYFSRLFPATGSVGTGVQILAVSHTGIKLLRMVKGSREA
GGQLQVLRTYSFADILFVTIPSQNMLEFNLASEKVILFSARAHQVKTLVDDFILELKKDS
DYVVAVRNFLPEDPALLAFHKGDIIHLQPLEPPRMGYSAGCVVRKKVVYLEELRRRGPDF
GWRFGTIHGRVGRFPSELVQPAAAPDFLQLPAEPGRGRAAAVAAAVASTAAAREVGRRRE
GPPVRAGSPDRAEDGLTLPPYTMLEFAQKYFRDPRRRPQDGLRLKSKEGRESRTLEDMLC
FTKTPLQESLIELSDSSLNKMATDMFLAVMRFMGDAPLKGQSELDVLYTLLKLCGDHEVM
RDECYCQVVKQITDNTSTKQDSCQRGWRLLYIVAAYHSCSEVLQPHLVRFLQDVSRTPGL
PFQGIAKACEQNVQKTLRFGGRVELPSSMELRAMLAGRSSKRQLFLLPGGLERHLKIKTC
TVALDVVEEICAEMALTRPEAFSEYVIFVVTNRGQHVCPLSRCAYILDVASEMEQVDGGY
MLWFRRVLWDQPLKFENELYVTMHYNQVLPDYLKGLFSSVPASRPSDQQLQQVSKLALLQ
HRAKDHSYLPSVREVQDYIPAQLYRTMAGSAWLNLVGQHRQQTQALSPHQARAQFLGLLS
ALPMFGSSFFFVQSCSNAAVPAPCILAVNQNGLNFLSTETHELMVKFPLKEIQSTRTQRP
TASSSYPYVEIALGDVTAQRTMQLQLEQGLELCRVVAVHVENLLSAREKRLTLPPSEITL
L
Download sequence
Identical sequences ENSFCAP00000014293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]