SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014510 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014510
Domain Number 1 Region: 53-417
Classification Level Classification E-value
Superfamily ARM repeat 3.76e-101
Family Diap1 N-terninal region-like 0.0000371
Further Details:      
 
Domain Number 2 Region: 551-556,613-900
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 7.98e-80
Family Formin homology 2 domain (FH2 domain) 0.00000664
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014510
Domain Number - Region: 438-514
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00785
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014510   Gene: ENSFCAG00000015646   Transcript: ENSFCAT00000015650
Sequence length 904
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:107535725:107700280:1 gene:ENSFCAG00000015646 transcript:ENSFCAT00000015650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFTEL
VDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLL
ALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKV
LQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF
RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDTTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEK
EEMMQTLNKMKEKLEKETSEHKQVKQQVADLTAQLHELNRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGGIMPPPGAPLGLALKK
KNIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQKEAD
AIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQ
LLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEV
KPKVEAIRSGSEEVFRSNALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLNKIADTKSSI
DKNITLLHYLITIVENKYPKVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVEMVS
TCFL
Download sequence
Identical sequences ENSFCAP00000014510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]