SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014543 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014543
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-42
Family Dual specificity phosphatase-like 0.000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014543   Gene: ENSFCAG00000015682   Transcript: ENSFCAT00000015686
Sequence length 167
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:23269501:23282499:-1 gene:ENSFCAG00000015682 transcript:ENSFCAT00000015686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGI
HVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECG
MKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRVRDTNGHCCVQ
Download sequence
Identical sequences A0A2I2URC5 E2R341
9615.ENSCAFP00000015910 ENSCAFP00000015910 XP_004740995.2.14098 XP_006734208.1.47382 XP_007092464.1.5354 XP_008692701.1.72690 XP_012419960.1.74151 XP_014936103.1.86478 XP_019285473.1.44245 XP_019692142.1.62641 XP_021539855.1.83697 XP_852076.1.84170 ENSFCAP00000014543 ENSCAFP00000015910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]