SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014555 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000014555
Domain Number - Region: 311-320
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014555   Gene: ENSFCAG00000015695   Transcript: ENSFCAT00000015699
Sequence length 670
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:61676294:61683123:1 gene:ENSFCAG00000015695 transcript:ENSFCAT00000015699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIVQTLPVPLEPTPEATTAPQPPAMGSVSSLISGRPCPGGPAPPRHHGPSGPTFFRQQD
GLLRGGYEAQEPLCPAVPPRKAVPGTSFTYINEDFRTESPPSPSSDLEDAREQRARNAHL
RGPPPKLIPVSGKLEKNMEKILIRPTAFKPVLPKPRGAPSLPSFLGPRAAGLSGSQGSLT
QLFGGPASSSSSSSSSAADKPLALSGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPANG
SPGGHLPSHGPGRGALPGPARGAPTGPSHSDSGRSSSSKSTGSLGGRVAGGLLGSGARAS
PDSGSCGERSPPPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDESEVTMCQAYE
DRQRHWPREREALREDGAAQAQRAQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLE
RRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALR
EARAALRVSEGRARGLQEAARARELELEACSQELQRHRQEAERLREKAGQLDTEAAGLRE
PPAPPATADPFLLAESDEAKVQRAAAGVGGSLRAQVERLRAELQRERRRGEEQRDSFEGE
RLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEPAPCI
CLEEITATEI
Download sequence
Identical sequences M3WN34
ENSFCAP00000014555 XP_003994379.2.62641 XP_006938161.1.62641 XP_006938163.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]