SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015437 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015437
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000126
Family BAR domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015437   Gene: ENSFCAG00000018382   Transcript: ENSFCAT00000018873
Sequence length 48
Comment pep:novel chromosome:Felis_catus_6.2:D1:35661681:35684780:-1 gene:ENSFCAG00000018382 transcript:ENSFCAT00000018873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQKFSQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERR
Download sequence
Identical sequences ENSFCAP00000015437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]