SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015460 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015460
Domain Number 1 Region: 702-1111
Classification Level Classification E-value
Superfamily ARM repeat 9.6e-55
Family Armadillo repeat 0.0083
Further Details:      
 
Domain Number 2 Region: 505-695
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.15e-29
Family Ankyrin repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 1071-1294
Classification Level Classification E-value
Superfamily ARM repeat 5.23e-20
Family Armadillo repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015460   Gene: ENSFCAG00000018865   Transcript: ENSFCAT00000018744
Sequence length 1433
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:176531955:176603941:1 gene:ENSFCAG00000018865 transcript:ENSFCAT00000018744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLPKKGLPRFDQIQDEETYLENLSVQRNASVFFEKYDRSEVQELLTTALVSWLSAKDD
VRSQLDIPCGIMSQMNNVSFSTAILLTPVDPVALLDYREVHQIIRELAVGIYCFNQIPSI
SLEANYDQSSSCQLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRTIMD
IDPDGKPQTNKDIFAEFSAAGLVDITKDPDFNGIYDEDMNEDPTYDPNSPEEKAVFMKYA
ENIMLKLTFSTIQVQQCENVFIFETAYWLTNAIKCNQDYLDICTYQRLQQRLYLQKKVIQ
KHFEKKTDLRKGIGYLKLICFLTPFLLSLKKKMKVPYLDSLLPLFSDDKVKTERELPPFI
YGRDFKCQHFHYKEDQYFHVHGGIEFDISTPSVENALEDFKNNLEKIRDCAANTFVEDLG
YKEHYSIPVMELNGKSYYVICFELETFYHQLYKTKWWGAINEIVNNLKPKRLPLTDAQLH
EQFKKKFGFKKAMKCKSIPFGMKSAVERGLSAVFHTFSRKTSSLTINISDEAGYAIFHHA
ALHNRVSIICQLCNASFNVNQRRFVMSSQGPTPLHLAAQACSLETTICLLCFKADYTLSE
KRGWMPIHFAAFYDNIGIIIALCRKDPSLIEAEATAENQCTPLLLAATSGALDTIQYLFS
LGANWRKTDIKGNNIIHLSVLTFHTEVLKHIIELNIPELPVWKTLVEMLQCESYKRRMMA
VMSLEVICLANAGYWKYILDAGTIPALINLLKCSKIKLQCKTVGLLSNISTHANIVHAIV
EAGGIPALINLLVSDEPELHSRCAVILYDIAQLENKDVIATCNGIPALISLLKLNTENVL
VNVMNCIRVLCMGNEQNQRAVRDHKGIQYLITFLSSDSDVLKAVSSATIAEVARDNREVQ
NAMASEGAIPPLVALFKRKHLSVQVKGAMAVESLASYNPCIQREFLEKSLSKYLLKLLKA
FQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYNFIINMLLSPSAKMQYVGGEAVIALSK
DSRMHQNQICEGNGIAPLVRLLRINKIAEGTLLSVIRAVGSICIGVAHTSNPISQQFVVE
ENAFPVLIHLLRNHPSPNIKVEVAFSLACIVLGNDLLQNELQENEGFKYADVLHLLHSQD
KDVCLRAGYALTLFAFNNRLQQYLILESGIMTVSIFEPFLESTIETEKAMAAFQIIILAK
VIIDMDHITLSARGVTILVDSLYSVHSTTIVLTGNLIASLAHSRAGIPEAFATLGTIQRL
CYHLYSEKEEVRTACSCALGYLTYNASAFRILLKECRNKPNQFLRLTNNISRDASINPAF
LKEFQMQQRVGLPALSLEKNGGPSITPVFKKGKEHRRKLKPKIQPRDSLTLIPPVTNLMG
LFNTTKKTTVSHNVFSFSSATSSDITEVSRPRIVFLSQLGKHVQKANPEPTEG
Download sequence
Identical sequences ENSFCAP00000015460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]