SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015711 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015711
Domain Number 1 Region: 2119-2418
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.38e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000609
Further Details:      
 
Domain Number 2 Region: 627-735
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 3 Region: 1312-1418
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-28
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 4 Region: 1036-1146
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-27
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 5 Region: 737-844
Classification Level Classification E-value
Superfamily PH domain-like 4e-27
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 6 Region: 1735-1824
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-22
Family PDZ domain 0.013
Further Details:      
 
Domain Number 7 Region: 1453-1558
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-21
Family PDZ domain 0.034
Further Details:      
 
Domain Number 8 Region: 1827-1920
Classification Level Classification E-value
Superfamily PDZ domain-like 3.06e-18
Family PDZ domain 0.045
Further Details:      
 
Domain Number 9 Region: 533-626
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.41e-16
Family First domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000015711
Domain Number - Region: 43-100
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0471
Family Protein kinases, catalytic subunit 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015711   Gene: ENSFCAG00000018332   Transcript: ENSFCAT00000018387
Sequence length 2432
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:134117736:134258070:-1 gene:ENSFCAG00000018332 transcript:ENSFCAT00000018387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKPVSVADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSD
VEKIHIYSLGMTLYWGADHEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSA
HIRNSNCAPSFSYVKQLVKLVLGNLSGTDQLSRNSEQKPDRSQAIRDRLRGKGLPTGRSA
TSDVLDIHKSPFSHQTFLNKGLSKSMGFLSIRDTQDEEDYFKDISSDNNSAREDSENTCS
PYQFKTSGPGIDVLPKKKIWASSMDLLCTDERDFSGETGGFRQYLPEAVTVRTSTTPRKK
EARYSDGSIALDIFGPQKVDPMFHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEP
IRRYKTYHSDIFSTSSESPSIISSESDFRQVRKSEASKRFESNSGLPGLDETPGQGPSQR
PSRQYETPLEGNLINQEIMLKRQEEEMMQLQARMALRQSRLSLYPGDTIKASMLDISRDP
LREMALETAMTQRKLRNFFGPEFVKMTIEPFISLDLPRSILKQTKKGKNEDNRRKVNIML
LSGQRLELTCDTKTICKDVFDMVVAHIGLVEHHLFALATLRDNEYFFVDPDLKLTKVAPE
GWKEEPKKKSKATVNFTLFFRIKFFMDDVTLIQHTLTCHQYYLQLRKDILEERVHCDDET
SLLLASLALQAEYGDYQPEVHGVSYFRLEHYLPPRVMEKLDLSYVKEELPKLHNTYVGAS
EKETELEFLKVCQRLTEYGVHFHRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRF
PWRETKKISFSKKKITLQNTSDGIKHAFQTDNSKVCQYLLHLCSSQHKFQLQMRARQSNQ
DAQDMERASFRSLNLQAESVRGFNMGRAISTGSLASSTLNKLALRPLSVQAEILKRLSCS
ELSLYQPLQNSAKEKSDKASWEEKPRGMSKSYHDLSQASLYPHRKNVIVNMESPPQTIAE
LVGKPLHQMARSDTESLAGFTKLNNSKSVASLNRSPERRKHESDSSSFEDPGQAYVIGMT
LHSSGNSSSQVPLKENDVLHKRWSMVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLD
LGVFISSITPGGPADLDGCLKPGDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQP
KEKIPKVPSTPVHIANGMKNYLKKPSYMQDSTVDSSEDHHWPHGTPRHISESSCGQSGGL
REGSLSSQDSRTESASLSQSQVNGFFASPAGDRTWQESQHGSPSPSVISKTTEKKRASAD
SNGNKTKNPGISDATDYSDRGDSDMDEATYSSTQDHQTPKKESSSSMNTSNKMNYKTFPS
SPPKPGDVFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRV
LAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPASKEHVPITPQCTFPDPDAQGQA
PEKMKKMTHVKDYSFVTEENTFEVKLFKNSSGLGFSFSREDSLIPEQMNASIVRVKKLFP
GQPAAESGKIEVGDVILKVNGASLKGLSQQEVISALRGTSPEVSLLLCRPSPGVLPEIDP
ALLTPLHSPAQVLPNNSKDSSQAACVEQGTSSDENETYDKNKKQCTSRRDSYSDSSGSGE
DDLVKAPAKIPNTLSNMVSQAQSQHEASNNQEDTICTMFYYPQKTPNKPELDDSNPPSPV
PLDMTLGQSYQPQSESASTNSMDKYHMHHISEPTRQESLTSLKNDLENHLEDFELEVELL
ITLIKSEKGSLGFTVTKGNQSIGCYVHDVIQDPAKSDGRLRPGDRLIKVNDTDVTNMTHT
DAVNLLRAAPKTVRLVLGRVLELPRMPVLPHLLPDIILTCNKEELGFSLSGGHDSLHQVI
YISDINPRSVAAVEGNLQLLDIIHYVNGVSTQGMTLEEAKRTLDMSLPSVVLKATRDGHP
VIPSSKRHTLATPQSTKANGHHTAEPCHKPALTPSNSSSKVNGEEIIEVLCPEGKCSTYQ
MKGSADLILSKESNVQEDDIYDDPQEAEVIQSLLDVVDEEAQNLLNQNNAAGDVSVPGSL
KTNGKLSEGRAEDTDCDGSPLPEDFTESMLKGENKVLSHSLIQKPQERKTDGDNEVAWAS
DELPMETTNLEDSNKDHPFLTNEELAAVPIVKVPPSGKYTGTKLKSVIRMLRGLLDQGIP
SKELENLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVG
KEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMV
SDRLRLALVRMQQLKGFVVRAMALEDIQTGETRHISHLNFTAWPDHDTPSQPDDLLTFIS
YMRHIHKSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQT
EDQYIFCYQVILYVLTRLQAKEEQTEQPQLLK
Download sequence
Identical sequences ENSFCAP00000015711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]