SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015796 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015796
Domain Number 1 Region: 791-801,828-1190
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.36e-96
Family Formin homology 2 domain (FH2 domain) 0.0000193
Further Details:      
 
Domain Number 2 Region: 240-346
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-23
Family PDZ domain 0.0036
Further Details:      
 
Domain Number 3 Region: 10-82
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000355
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015796   Gene: ENSFCAG00000007510   Transcript: ENSFCAT00000007512
Sequence length 1206
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:4573220:4605634:1 gene:ENSFCAG00000007510 transcript:ENSFCAT00000007512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASAAMPATNQGWPEDFGFRLGGSGPCFVLEVTEGSSAHAGGLRPGDQILEVEGLAVGGL
SREHLVRLARRCPRVPPSLGVLPGPDGGPAAGSGRASPTAALRPLRPSRGLSLGRELLRL
TGRKRPEAVYRERRRKAQEFSRKVDEILGDQPTAKERVFAALKQFAAQQRVDDLVWALTL
VLPREARAPLMDNLRIFIPKKHRARFDEVVSQGLLGKHTWGGAGAGQERLSAAGHGTSLS
PMPPSLSLPRAGHAASPPLHLFFLPRTVRVYKGNKSFGFTLRGHGPVWIESVLPGSPADN
ASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAVPTLVVEEGLVPFASDSDSLDSPNPS
SALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYGVCRALESFFQHRNIDTLIVDV
YPVLDTPAKQVLWQFIHQLLTYEEQELCREKIACFLGYTAMTAEPEPELDLEPEPEPEPE
PVLEPQRRSSLRASSMCRRSLRSQGLEASLSCAGPGDCPEMPLPLIPGERQAGDGTSLPE
TPNPKMMSAVYAELESRLSSSFKGKVGTTSRSRASPPVPSPAGAAGPRTLSSVSWPSERL
LPSPCYYPLCSGGLASPSSSESHPYASLDSSRAPSPQPDPGPIRSDSPPSPDPARPPSRR
KLFTFSRPMRSRDTDRFLDVLSEQLGPRVTVVDDFLSPENDYEEMSFHDDQGSFVTNERS
SASECISSSEEGSSLTYSSVSDHIPPPPLSPPPPPPLPFHDPKPSSRTPDGPRGPAQTLV
KPLTQLSHPVPPPPPPPLPPPVPCAPPMLSRGLGHRRSETSHMSVKRLRWEQVENSEGTI
WGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPLPGPEPFRKKEVVEILSHKKAYNTSI
LLAHLKLSPAELRQVLMSMEPRRLEPAHLAQLLLFAPDADEEQRYQAFREAPGRLSEPDQ
FVLQMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQASLELKNSRKLAKILEFVLA
MGNYLNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHILAKSLSQHFPELLGFAQDL
PTVPLAAKVNQRALTSDLADLHGTIGEIQAACQSTPPSSEDKFAVVMTSFLETAQPVLRA
LDALQREATEELGRALAFFGEDSKATTSEAFFGIFAEFMSKFERALSDLEAGDGPRSSGM
VSPLAW
Download sequence
Identical sequences ENSFCAP00000015796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]