SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015859 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015859
Domain Number 1 Region: 102-196
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 24-77
Classification Level Classification E-value
Superfamily L27 domain 2.2e-20
Family L27 domain 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015859   Gene: ENSFCAG00000018733   Transcript: ENSFCAT00000019012
Sequence length 232
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:8279658:8282899:-1 gene:ENSFCAG00000018733 transcript:ENSFCAT00000019012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRPGRRAAGGGGADMAALVEPLGLERDVSRAVELLERLQRSGELPQKLQALQRVLQSRF
CSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFN
IMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGS
VKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSIPQSTALGPGPALSHAS
Download sequence
Identical sequences ENSFCAP00000015859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]