SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015896 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015896
Domain Number 1 Region: 216-300
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000486
Family PDZ domain 0.023
Further Details:      
 
Domain Number 2 Region: 690-739
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000538
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015896   Gene: ENSFCAG00000018713   Transcript: ENSFCAT00000018574
Sequence length 1005
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:75857311:75926443:-1 gene:ENSFCAG00000018713 transcript:ENSFCAT00000018574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGETVPFIKTIRLLRPVVPSAGGEPDGPEGEALPATSPEELAFEAEVEYNGGFHLAIDVD
LVFGKSAYLFVKLSRVVGRLRFVFTRVPFTHWFFSFVEDPLIDFEVRSQFEGRPMPQLTS
IIVNQLKKIIKRKHTLPSYKIRFKPFFPFQTLQGFEEDEEEHIHIQQWALTEGRLKVTLL
ECSRLLIFGSYDREANIHCTLELSSGVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTD
GYAGHVIIETVAPNSPAALADLQRGDRLIAIGGVKITSTLQVLKLIKQAGDRVLVYYERP
VGQGGQGTALQDHFGQLEEHFLSASCPPNYEEETPALAADAENRDLDSEFEDLAGDVRAQ
TELKDEAPSLSHSPKRTPTTLSVKPLGTISPVLNRKLAVGSHPPPPKPPCKEGNKPSALK
ASEVTDPTQVSKPTQGSTFKPPVPPRPQVKVPLPSADAPSQTEPDVPAEKPEKVLPPPPA
DKPAEKQAKTTDHTEDAAASKQFLAKQDMVRDFPSESSCPPKDSSDDPQTWESSEIPYRN
KLGKWTRSRATCLFDIEACHRYLNVALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSN
MEYFSKFRLEAPSPKAMVTRTALRSLSVQKGFNDKFCFGDITIHFKYLKEGEPDHPVVPN
LEKEKDLHLIEEVPALPKEEHLVGQMGLTENKHSFQDTQFQNPTWCDYCKKKVWTKAASQ
CMFCAYVCHKKCQEKCLAETPLCGAADRRIDRTLKNLRLEGQEGFLGLPPRVDAEASKSV
NKTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTELVEPSPKHTPNTSDNEGSDTEVCGPN
SPSKRGNNTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEID
QELEHNNSLVREEKETTDTRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDLESLESLS
LDQPSKKSKYTDDTEEDLDNEITQLIDSQPFSSISEGLFGPSESV
Download sequence
Identical sequences ENSFCAP00000015896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]