SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015898 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015898
Domain Number 1 Region: 63-119
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-18
Family Fibronectin type II module 0.0028
Further Details:      
 
Domain Number 2 Region: 32-75
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000103
Family Fibronectin type II module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015898   Gene: ENSFCAG00000010612   Transcript: ENSFCAT00000010615
Sequence length 119
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:10801139:10801832:-1 gene:ENSFCAG00000010612 transcript:ENSFCAT00000010615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVQAGEDESNFVTSQLTLPERDEGSLFSLDGKCVFPFQYRGGIFYDCIKFKAKHKWCSLT
ETYQGRWKYCSEEDFAKCVFPFWYRRLIYRECTEHGEAFGRKWCSLTQNYNKDKVWKYC
Download sequence
Identical sequences ENSFCAP00000015898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]