SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015920 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015920
Domain Number 1 Region: 624-915
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.26e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000848
Further Details:      
 
Domain Number 2 Region: 217-363
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 115-219
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-37
Family Second domain of FERM 0.0000711
Further Details:      
 
Domain Number 4 Region: 512-606
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-20
Family PDZ domain 0.0000106
Further Details:      
 
Domain Number 5 Region: 29-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.48e-19
Family First domain of FERM 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015920   Gene: ENSFCAG00000018410   Transcript: ENSFCAT00000018599
Sequence length 928
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:118556873:118681054:-1 gene:ENSFCAG00000018410 transcript:ENSFCAT00000018599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNQRFSLMSSYFYMLFEPSEQKSRVLYYVTCEVFILNQKRIKIQELKNKHDQGQVLLDIV
FKHLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQ
EEYTRYQYFLQIKQDILTGRLPCPYNTAALLASFAVQSELGDYNQSENLPGYLSDYSFIP
NQPQDFEKEIAKLHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMS
GGILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLW
KACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARS
PSKPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGH
LVDHVVHTSPSEVFVNHRSPSSTQANSIVLESSPSQETPGDGQPPALPPKQSKKNSWNQI
HYSHSQQDLENHINETFDVPSSPEKSTPNGGIPQDNLVLIRMKPDENGRFGFNVKGGYDQ
KMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELV
LLVRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQ
FDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSS
IINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTASSSYGC
YQVTCHSEEGNTAYIFRKMTLFNQEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVR
NKRAGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTP
SQYRFVCEAILKVYEEGFVKPLTTSTNK
Download sequence
Identical sequences ENSFCAP00000015920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]