SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015930 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000015930
Domain Number - Region: 60-69
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015930   Gene: ENSFCAG00000018807   Transcript: ENSFCAT00000018090
Sequence length 358
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:13417563:13423452:1 gene:ENSFCAG00000018807 transcript:ENSFCAT00000018090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAVGDPKMSSPRSPPLEPPAPSPGIPVPQGPITPLLSLPPNLPNLALLPPASSLQAPIP
PPPPLPPPPAVGGPAPPHVFGLEKSQLLKEALEKAGPVPRSRDDVKRLLKLQKDRFRSDL
QWILFCADLPSLIQEGPQCGLVALWMAGTLLAPPSGIPLERLVQMAVDRGYTAQGEMFSV
ANMGKLAQEALGCQAELLCGGLGGPNRDRVLRHLVSGHPLLIPYDEDFNHEPCQRKGYKA
HWAVSTGVLLGTQAVPGLGYSEDPELPGLFHPVPSTARQLPSLPEEGSPGAVYLLSKQGK
SWHYQLWDYDQVRDSNLQLTDFSPSRAADGRAYVVPAGGVRAGLCGQALLLSPKDSSC
Download sequence
Identical sequences M3WP95
XP_003997907.2.62641 ENSFCAP00000015930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]