SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016038 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016038
Domain Number 1 Region: 754-984
Classification Level Classification E-value
Superfamily vWA-like 5.19e-45
Family Integrin A (or I) domain 0.00084
Further Details:      
 
Domain Number 2 Region: 44-227
Classification Level Classification E-value
Superfamily vWA-like 9.79e-31
Family Integrin A (or I) domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1087-1143
Classification Level Classification E-value
Superfamily BPTI-like 1.4e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016038   Gene: ENSFCAG00000018957   Transcript: ENSFCAT00000019182
Sequence length 1145
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:101436043:101608385:-1 gene:ENSFCAG00000018957 transcript:ENSFCAT00000019182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNRHFVFYLLLLPAFMSQTIRGQRKKGSKSNLLAKKNNFQDSTCFIDVVFIVDSSESSK
IVLFDKQKDFVASLSDKVFQLTPVRSLKYDIKLAALQFSTSVQIDPPFSSWKDLKTFKQR
VKSMNFIGQGTFSYYAISNATSLLKREGRKDGVKVALLMTDGIDHPKNPDVKSISEDART
AGILFITIGLSTVVNEAKLRLISGESSSEPILLLSDPTLEDKIQDRLDILFEKKCEHKIC
ECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGDAQKGEPGERGPGGIPGYKGEKGENGEC
GKPGIKGDKGSLGPYGPKGPRGLQGISGPPGDPGPKGFQGNKGEPGPPGPHGPPGAPGIG
QQGIKGERGQEGRTGAPGPIGIGEPGQPGPRGPEGAPGERGLPGEGFPGPKGEKGSEGPI
GPQGLQGLSIKGDKGDLGPAGPQGPMGIPGIGSQGEQGIQGPMGPPGPQGPPGQGLPGSK
GEVGQTGATGPRGPVGIGVQGPKGEPGSTGLPGQPGVPGEDGAAGKKGEAGLPGTRGPEG
PPGKGQPGPKGDEGNKGSKGNQGQRGFPGPEGPKGEPGIMGPFGMPGASIPGPPGPKGDR
GGPGMPGFKGEPGIAIRGPKGAQGPRGPVGAPGLKGDGYPGVAGPRGLPGPPGPMGLRGV
GDTGAKGEPGVRGPPGPSGPRGIGTQGPKGNIGQKGLPGPPGPPGYGLQGIKGEQGPQGF
PGPKGMTGHGLPGQKGEHGERGAMGKKGDKGEIGEPGSPGKQGLQGPKGDAGLTKEEIIK
IIFEICGCGPKCRETPLELLFVIDSSESVGLENFQIIKNLVKTLSDQVALDLATARIGII
NYSHKVEKVAHLTQFSNKDDFKLAVDNMQYLGEGTYTATALHEANHMFEAARPGVKKVAL
VITDGQTDIRDEKNLTEVVKKASDMNVEIFVIGVVKKNDPNFEMFHKEMNLIATDPDSEH
VYQFDDFITLQEDTLKQKVFKKKCEDFDSYLIQLGSPLLQPGLGISEEELGGSTPEPQEE
ISESVTVSGAQDKEKEPNWADGLTTTPSPEAATTQEPLLSLPEEGADGLETRIPSPILNL
KPEKLAHQDPRCLEPLKPGDCGKYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSENECQE
ICIQG
Download sequence
Identical sequences ENSFCAP00000016038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]