SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016091 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016091
Domain Number 1 Region: 55-383
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.81e-62
Family Ankyrin repeat 0.000053
Further Details:      
 
Domain Number 2 Region: 407-595
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.35e-42
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016091   Gene: ENSFCAG00000018761   Transcript: ENSFCAT00000018943
Sequence length 1119
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:21635945:21689634:-1 gene:ENSFCAG00000018761 transcript:ENSFCAT00000018943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSLRKMLSPGGKQEPQGAVYQGVENGTDGRKDSLKVVFEGSTCRFNLMKKRKKLSKYD
DVNTSPLHHAAEEGQVQLMGMIINDSSFEVLNVMDDYGNTPLHWATENQVESVKFLLSKG
ANPNLRNGNMMAPLHIAVQGLHNEVMKVLTEHNNTNINLEGENGNTAVIIACAKDNSEAL
QILLNKGAKPCKANKWGCFPIHQAAFSGAKKCMEIILKFGEEHGYSRESHINFVNNAKAS
PLHMAVQSGDLEMIKMCLDNGAQLDLMENGKCTPLHFAATQGATEIVKLMISSYSGSSDI
VNAVDGNQETLLHRASLFDHHELADYLISVGADINSTDSEGRSPLILATASASWNIVNLL
LSKGAHVDIKDHLGRNFLHLTVQQPHGLKNLQPEFMQMQHIKKLVMDEDDDGCTPLHYAC
RHGIPVSVDNLLDFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDMNDTRLLNEGDLH
GMTPLHLAAKNGHDKVVQLLLKKGALFLSDHSGWTALHHASLGGYTQTMKVILDTNMKCT
DQLDEEGNTALHFAAREGHAKAVALLLSYDADIVLNKQQASFLHVAIHNKRKDVVLTTIK
NKRWEECLKVFSHYSPSNKCPVMEMVEYLPECMKVLLDCCMMPSKRDKSCQDYYIEYNFR
YLQCPLEFTKKVTPAQDVTYEPLTTLNERMSVALARLFLISFPVVCKEYLLMKWLAYGFR
AHIMNLGSYCLGLLPMTFLVVSIKPGMAFNSTGIINETSDHSEILDTKNSYSIKVCMILV
FLSSIFGYCKEVVQIFQQKRNYILDNANGAEWIIYTTSIIFVSPLFIGIPAYVQWQCGAI
AIYLYWMNFLLYLQRFENCGIFIVMLEVIMKTLLRSTVVFVFLLLAFGLSFYVLLNIQDA
FSSPLLSIIQTFSMMLGDINYRDAFLEPFLRNELVYPVLSFAQLIAFTMFVPIVLMNLLI
GLAVGDIAEVQKHALLKRIAMQVELHTSLEKKLPLWFLRKVDQKSIIVYPNRPRCTGLLA
IFHFIFYTQEERQEIPNVDTSLETEILKQKYRLKDLTSLVEKQHELIKLIIQKMEIISET
EDEDNHHSFQDRFKKEQLEQRNSKWNSVLKAVKAKTHCP
Download sequence
Identical sequences ENSFCAP00000016091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]