SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016232 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016232
Domain Number 1 Region: 572-660
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-19
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 386-479
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 291-337,515-571
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000628
Family Second domain of FERM 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000016232
Domain Number - Region: 19-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00152
Family Ubiquitin-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016232   Gene: ENSFCAG00000019220   Transcript: ENSFCAT00000018522
Sequence length 683
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:32031570:32060616:-1 gene:ENSFCAG00000019220 transcript:ENSFCAT00000018522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPAFATMLSSTDFASASWELVVRVDHPNEEEQKDVTLRVAGDLHVGGLMLKLVEQINISQ
DWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNVKTVRLRVSFS
AVVFKAVSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKTNKEPIIEDILNLEGSPTTS
GPPVSPGLYSRTMTPTYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADM
YQPRSLVDKTKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYTFFDLNPKYDAVRINQLYE
QARWAILLEEIDCTEEEMMIFAALQYHISKLSLSAETQDFTHESEVDEVEAALSNLEVTL
EGGKMDNTLEDITDIPQLADNLKLFRPKKLILKAFKQYWFIFKDTSIAYFKNKELEQGEP
VEKLNLRGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYAQWMAACILASKG
KTMADSSYQPEVLNILSFLRMKNRNSASQVASNIETMDINPECFVSPRCAKKHKSKQLAA
RILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIRID
ATTGIPITTWRFTNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLS
TRSKDQNETLDEDLFHKLTGGQD
Download sequence
Identical sequences ENSFCAP00000016232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]