SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016312 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000016312
Domain Number - Region: 112-160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00982
Family Motor proteins 0.026
Further Details:      
 
Domain Number - Region: 61-110
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0236
Family Motor proteins 0.044
Further Details:      
 
Domain Number - Region: 37-46
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0602
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016312   Gene: ENSFCAG00000019068   Transcript: ENSFCAT00000019101
Sequence length 202
Comment pep:novel chromosome:Felis_catus_6.2:A2:20112182:20114008:1 gene:ENSFCAG00000019068 transcript:ENSFCAT00000019101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIWFCKDGQFCEITIEEDIDETRSMKKKEKKKKIQPSPTPPPPPPKVSERSSKLKLKKK
KLPDQEQKAIQIQAWWRGTLVRRMLLHATLRAWIIQQWWKMTLAKLLEKRKRAALESYAQ
QERAVVKLQSLVRMWHIRQRYCRLLHAARIIQLYWRWHNCHSRGFFQGSYDLTASHLGLE
LEIFLGSQICRITDCIPFPIKS
Download sequence
Identical sequences ENSFCAP00000016312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]