SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016336 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016336
Domain Number 1 Region: 322-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 594-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000038
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 677-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000204
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 4 Region: 479-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000114
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 5 Region: 637-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000764
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 562-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000202
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 444-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000654
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000016336
Domain Number - Region: 189-200
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 48-78
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00177
Family C2HC finger 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016336   Gene: ENSFCAG00000018478   Transcript: ENSFCAT00000018086
Sequence length 854
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:25106064:25144815:-1 gene:ENSFCAG00000018478 transcript:ENSFCAT00000018086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETPFCCCCFSGMDNQTVLAVQSLLDGQGAVPDPTGQSVSAPPTIQPLDDEDVFLCGKCKK
QFNSLPAFMTHKREQCQGNAPPLATVSLATNSIYTPSAAPTAVQQAPPPANRQISTYITV
PPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPQGPPPVQSSLNMHSAPSYLSQPPP
PPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNPGGNGVVEVYSATEPLAGSGTVEIQALGM
QPYPPLEVPNQCVEAPVYPTPPVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPPTLK
TRRAKGASGLPEAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFA
QKSNVKKHMQTHKVWPPGRSGGTVSRNSVTVQVMALNPSRQEDEENTGLGQTLSGAPQPQ
ALPTAGEDEGDKLEAKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKCVVKSC
AQTFPKLDTFLEHIKSHQEELSYRCHLCGKDFPSLYDLGVHQYSHSLLPQHSPKKDSAIY
KCVKCVNKYSTPEALEHHLQTATHNFPCPHCQKVFPCERYLRRHLPTHGSGGRFKCQVCK
KFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGC
SKEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGF
SRHKYLKDHRCRLGPQKDKDLQARRPSRRRAAPRSGSSGGRKVVTPLSDPLGLEELKDTG
AGPVPEAAPGKPPFSEPDAVLSIVVGGTVGGEPELVVPGHAESLGSNLALAELQAGTEGP
CAMLAVPVYIQASE
Download sequence
Identical sequences ENSFCAP00000016336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]