SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016344 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016344
Domain Number 1 Region: 433-572
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000995
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000016344
Domain Number - Region: 214-342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000273
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 28-131
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00122
Family CRAL/TRIO domain 0.013
Further Details:      
 
Domain Number - Region: 346-469
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00256
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016344   Gene: ENSFCAG00000018813   Transcript: ENSFCAT00000019211
Sequence length 666
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:167078296:167205529:-1 gene:ENSFCAG00000018813 transcript:ENSFCAT00000019211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTIPICLHHTELPPLFTDSTLVLSSEKCKARGFTVIVDGRKSQWNVVKTVVLMLQNVVPA
EVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSLT
YDHMDWLNKRLVFEKFTKESTSLLDELALINNGSDKGSQQEKERSVDLNFLPSVDPETVL
QTGHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSK
RTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVY
VELNQQIAALLNAGDEEDLVELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQDL
SQQLDGLLGMLCVDVAPADGASIQQTLKLLEEKLKSVDVGLQGLREKGQGLLDQISNQAS
WAYGKDVTIENKENVDHIQGVMEDMQLRKQRCEDMVDVRRLKMLQMVQLFKCEEDAAQAV
EWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQSTYDYGRQLLQATVVLCQSLR
CTSRSSGDTLPRLNRVWKQFTIASEERVHRLEMAIAFHSNAEKILQDCPEEPEAINDEEQ
FDEIEAVGKSLLDRLTVPVVYPDGTEQYFGSPSDMASTAEHIRDRMKLVSLKRQQLRHPE
MMTTES
Download sequence
Identical sequences ENSFCAP00000016344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]