SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016358 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016358
Domain Number 1 Region: 269-507
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-64
Family Nuclear receptor ligand-binding domain 0.000000292
Further Details:      
 
Domain Number 2 Region: 28-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016358   Gene: ENSFCAG00000018105   Transcript: ENSFCAT00000019025
Sequence length 518
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:103919494:103942074:-1 gene:ENSFCAG00000018105 transcript:ENSFCAT00000019025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAPQRQHRASQELLAAKKTHSSQIEVIPCKICGDRSSGIHYGVITCEGCKGFFRRSQQ
CNVVYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQRQQQQQRGQVAKTPPAGGQGADALACPVGLPDGQLPLGSSPDLPEASACPPGLLRAP
GSGPSCPSSLAKAGPNGASYHLGHSPERGKAEARDGFYGTGSQLPPDTCGLHFEDPRHPG
LEEPGQGPDSYCSPSFHSTPEVPYASLTETEHLVQNVCKSYRETCQLRLEDLLRQRPNIF
SREEVAGYQRKSMWEMWERCAHRLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNHTVFFEGKYGGTELFRALGCGELISSIFDFSHSLSTLRFSEDEIALY
TALVLINANRPGLQEKRKVEQLQHNLELAFHHHLYKTHRQGILAKLPPKGKLRSLCSQHV
EKLQTFQHLHPIVVQAAFPPLYKELFSTEIESPEGLSE
Download sequence
Identical sequences ENSFCAP00000016358 XP_003990686.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]