SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016361 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016361
Domain Number 1 Region: 25-157
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.37e-38
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016361   Gene: ENSFCAG00000018835   Transcript: ENSFCAT00000018291
Sequence length 180
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:64834658:64849086:1 gene:ENSFCAG00000018835 transcript:ENSFCAT00000018291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPTTTQCAPSHCPIVASGVQQTLEEMDFDRGIWSAALNGDLGRVKYLIQKATDPSQPDSA
GYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNP
RLVDDDGMTSLHKAAEKGHVDICSLLLQHSPALKAVRDRKARLACDLLPCDSDLRDLLAS
Download sequence
Identical sequences ENSFCAP00000016361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]