SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016593 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016593
Domain Number 1 Region: 118-474
Classification Level Classification E-value
Superfamily ARM repeat 1.8e-107
Family Diap1 N-terninal region-like 0.0000000154
Further Details:      
 
Domain Number 2 Region: 644-1021
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.49e-106
Family Formin homology 2 domain (FH2 domain) 0.00000000471
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000016593
Domain Number - Region: 579-624
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0968
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016593   Gene: ENSFCAG00000027832   Transcript: ENSFCAT00000031017
Sequence length 1188
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:35468264:35970636:-1 gene:ENSFCAG00000027832 transcript:ENSFCAT00000031017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRHRPRLHHPKQGSAAGTPYPSSASLRSCRESKMPGRKGPQHPPPSGAEEPGEKRPKFH
LNIRTLTDDMLDKFASIRIPGSKKERPPLSNLKTAFASNDCSSEMMENIPKPLSENEVLK
LFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKSRRQISPQEFIHELK
MGSADDIVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKIVKKKQHK
VIQCLKALMNTQYGLERIMSEERSLSLLAKAIDPKHPSMMTDVVKLLSAVCIVGEESILE
EVLEALTSAGEERNVDRFSSIVEGLRHDSAQLQVACMQLINALVTSPDDLDFRLHIRNEF
MRCGLKEILPNLKCLKNDGLDIQLKVFDEHKEEDLLELSHRLEEIRAELDEAYDIYNMVW
NTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFSYRKRL
DLDLSQFVDACVDQAKLEEFEEKASELYKKFEKEFTDHQETQAQLQKKEAKINELQAELQ
AFKSQFGALPADTSNSSPLAEENGSGLPALAPSLPLPSCGGVPPPPPPPPPPPLPGMPLP
FGGPVPPPPPLGFLSGRNSPPPPTLPFGLKPKKEFKPETSMRRLNWLKIRPHEMTENCFW
IKANENKYENVDLLCKLENTFCCQQKERREEEDLEEKKAIKKKIKQLKFLDSKIAQNLSI
FLSSFRVPYEEIKMMILEVDETQLAESMIQNLIKHLPDQEQLSSLSQFKSDYNNLCEPEQ
FAVVMSNVKRLRPRLSAILFKLQFEEQVNSIKPDIMAVSTACEQIKKSKSFSKLLELVLL
MGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEMCEEKYPDILTFVDDLE
HLDKASKVSVETLEKNLKQMGRQLQQLEKDLETFPPPEDLHDKFLTKMSISFXXXKEQYG
KLLKLHENMETLYQSVMGYYAIDVKKVSVEDFFNDLNNFRTTFMQARKENIKKREAEERE
KRAQIAKELAEKERLERQQKKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKP
KDIRRSFSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNLDTHTS
TERIKAVEKKEACNVESNRKKEMELLGSVSKNESVPEVEALLARLRAL
Download sequence
Identical sequences ENSFCAP00000016593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]