SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016714 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016714
Domain Number 1 Region: 615-681,995-1099
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-30
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 903-993
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0086
Further Details:      
 
Domain Number 3 Region: 1123-1223
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-20
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016714   Gene: ENSFCAG00000023062   Transcript: ENSFCAT00000022406
Sequence length 1244
Comment pep:novel chromosome:Felis_catus_6.2:A1:164223703:164330523:-1 gene:ENSFCAG00000023062 transcript:ENSFCAT00000022406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPSCLGEPQPTNQVYQKNIKDLEKEVKGDTPEAKFHQIRALGKSKENGDEHTSASVNGK
QNSLFLPKDNKQLSSDSKISREKENDDPPSSISHQRDKVLSVAMFNDCKESLSEKIILQD
FPNTVEAFKPAKGKIITEVKCGAFSVQVEIKNRFFCETGMQFPTKRRCPKCHQHYFSRHS
QRCYTSRSCSSIYRNMLVEDLKPEVPSESEGEGARKGRPSLKVSIVGKEIKVKYMSKKQN
ILINIAYPKRRGKRAKYRNISSGHTTEECSRSSLQSDIRCPEKWKLENKHQSSDCSPVSP
PIVCAIQKEKNVDREVECLCSTPEREKTKPGSLSSVLDDCEVESAMSQQKDFKIGQNILK
KKNFSEAEPLLKKIPPISQGTLKTTSLSDTDLSSMPFEDLKDVDRERKLVFDIPENITSD
SCTRQSPEGINYLPSAITDIFPVQDGKDSDFCSSSSLSRQVVGEKAASTHCKGSKIPTAD
CCEESSSLSLPSSQNVLKPSTSFSPSHWATRQSEVKEVPGDTFSFNHCAELLKTCEEEHI
DMTDRDFNKAALHSDSRTNAQQLLEMKSTRCPTLSPESSSSLSASSPLNRNSHSTVEWSQ
TKSQTGHPEIAVPSKTTELVMTLITDELEQRLIIHNDKGGTVHSNCPMGIKNPKDSPSSL
GNGEKDKLEIMPVVKNACHRDFEGLSNENHNEVCFQMDLPNTTEFNCTECAADNLFIEKT
LTNDADQYGNQDDKGLGLTSFKEEPAEYQRIASTKPDFEGDRNDPKETYYHQIDILLSPR
KQKALTDWNLEINSLRKLSQELAPRGTRASDGSQEEAIDQWARRRQQFKDGKRCSSAGES
SFTSNITEGSITSEDGCSVDLGFRVDLEEKGFYTENFHSAAWVFRGDDGNPEDSPRCLSK
KPRPVAVRERTVRLFKGTGDYPWGFRIQFSKPIVVTEVDANSAAEEAGLQIGDVVLAVNG
TEVTSVEHAEAVHLARKGPDILTLVVGSDISRCPNTPWPTCRGYLHKRTHSGFVKGWRKR
WFVLKHDGCLHYYRHKKDEGKCSPLEVIKLEGAEVGIDSSLGKPFVFNCVPQSGNRTFCF
CATSNQEMKRWLEAMDKAIHPVRQNHVWEDVTLHNSNLPPLAIKNPECLGLLHQLDRNTD
MWVQHYCILKDGCLYFYASIRSTQAAGGLYLQGYRVNEQILSFKQSVIELKPPSEEFKTF
YFCAENNTENQRWITALKASIKKWLPLHQAIQDFMNRPLEETRM
Download sequence
Identical sequences ENSFCAP00000016714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]