SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016775 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016775
Domain Number 1 Region: 62-377
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.19e-103
Family Protein prenylyltransferase 0.0000000000108
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000016775
Domain Number - Region: 21-31
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016775   Gene: ENSFCAG00000028404   Transcript: ENSFCAT00000027481
Sequence length 381
Comment pep:novel chromosome:Felis_catus_6.2:B1:41045565:41078453:-1 gene:ENSFCAG00000028404 transcript:ENSFCAT00000027481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATEGVGEAARGSASGQPEPPPPQPHPPPPQQQQPQEEAMAAESGEAVASPMDDGFLSL
DSPTYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFK
LTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEW
LKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWN
QRYFVISNTTGYNDRAILEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQ
LLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRY
IGRSLQSKHSTESDPPTNVQQ
Download sequence
Identical sequences M3WQZ3
ENSFCAP00000016775 XP_003984787.1.62641 XP_019296178.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]