SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016866 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016866
Domain Number 1 Region: 10-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016866   Gene: ENSFCAG00000031695   Transcript: ENSFCAT00000027897
Sequence length 103
Comment pep:novel chromosome:Felis_catus_6.2:D2:52330691:52331595:-1 gene:ENSFCAG00000031695 transcript:ENSFCAT00000027897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIQIKQNVLFLQGLVSFKDVSVSFTQVEWQWLDSAQKILFRDVMLENYSKLVSVGCLTIK
PDVISQLEQGEEPWIIEVMFSSQSLPGELLCTQEMEATGNQIL
Download sequence
Identical sequences ENSFCAP00000016866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]