SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016945 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000016945
Domain Number - Region: 17-72
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00491
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016945   Gene: ENSFCAG00000023104   Transcript: ENSFCAT00000022024
Sequence length 84
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:88439741:88441604:-1 gene:ENSFCAG00000023104 transcript:ENSFCAT00000022024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QATGTDQVVGLGLVAISLIIFTYYTAWVILLPFIDSQHVVHKYFLPRAYAVAIPLAAGLL
LLLFVGVFITYVMLKNQKVTKKAQ
Download sequence
Identical sequences ENSFCAP00000016945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]