SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016953 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000016953
Domain Number - Region: 829-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000194
Family HkH motif-containing C2H2 finger 0.046
Further Details:      
 
Domain Number - Region: 1146-1153,1231-1272
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00863
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 
Domain Number - Region: 764-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.025
Family HkH motif-containing C2H2 finger 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016953   Gene: ENSFCAG00000009726   Transcript: ENSFCAT00000023281
Sequence length 1970
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:44012769:44040647:-1 gene:ENSFCAG00000009726 transcript:ENSFCAT00000023281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGDHSGFSSGTRNYRQRRRSPSPRFLDPEFRELDLARRKREEEEERSRSLSQELVGVDG
GDTSCSIPGLSGVLTTSEPGYSLHRPEEVSAMPKKSILKKRIEVDMEPSIQLESFSSNTS
PSQDHPVYSGHPSLPLSGAIAAFASEIENKGTMVETTLKEPQGNLYQWGPLPGMPKDNSP
LREKFGSFLCHKEKLNMKPEGPERHTDFLLPHERASQDGSGFSRILSMLADSTSTQEKRR
RSFPDIEDEEKFLYGDEEEDLKAESPPKPLGSSENEVMRQKASSLPSSAPAVKLESIEDT
NPEYAKIHDLLKTIGLDIGVAEISKLAARTQERLHGKKPSRSSADRRPSVDRHFSAERCS
SVDHHFSADRHSSEPHRLESREAHHSNTHSPEVSHPHPVSPVDPYLLTKNSPPFLKSDHS
VGHIAGPEVVGSGFQSSVAVRCMLPSAPSAPIRLPHPASLSQFHMPRASQFAAARIPPNY
QGPAIPPASFDAYRHYMAYAASRWPMYPASQPSNHSLPEPHRVMPVTKQPTRSRPNLRVI
PTVTPDEPKQEESVLGSIPTAQVPVQVSIPSLIRYNPEKISDEKNRASQKQKVIEEREKL
KSDREARQKKMYYLRTELERLHKQQGEMLRKKRREKDGHKDPLLVEVSRLQDNIMKDIAE
LRQEAEEAEKKQSELDKVAQILGINILDKSQKSSNDSKETTEKAGKAEKSKSPEKVSSTS
SSSSNSKESKINSENSHTKSPKPAESLQPATKHSDQPIAAYEYYDAGNHWCKDCNTICGT
MFDFFTHMHNKKHTQTLDPYNRPWASKTQSEAKQDAVKRTDKITVPAKGSEFLIPITGYY
CQLCEEFLGDPISGEQHVKGHQHNEKYKKYVVENPLYEERRNLDRQAGLAVVLETERRRQ
NELKRKLSEKPKEEKKEKKAKVLKEVKEDDRVSEELEDQLSEGGNSPEKAENKRKGSIKL
QLKEEVKKESPTSFGKFSWKKPEKEEEKSSMVPSIPKEEVVENSKDKEDGKAEAGKAKPI
KIKLSGKTVVAHTSPWMPVVTTSTQTKIRPNLPIPSTVLRKSGSATVSKPAPLNTFLSIK
SSGTTAKPLPVVKESSADLLLPPDIISKAFGGEEVILKGSPEEKMVLAEKNEPSHIPEQV
LPPPPPPPPPPPPPPPVIPHLASPSPAQTNAVLAPVKSNPAVSHTLSPGFLGPNILNPVL
PVAIMASAQPAAIPSDETAPGVSESDRDQTLFSVLVRPPPPLSSVFSEQAKKLEKRNSCL
ATANAKDLYDIFYSSGGKGAPETKLSGGLLANGENSNLSRVESSDTSSTSTLNNSTSQEG
LPPDRSLISAPEKPTAKTLVSLGKWSVVEHTDSENRGSGYGFLQPLTRLCHSRPYETITP
KTDTLAMWTSSSFQSDTNRDISPGGKIELDLGEPGPPGVEPAPQLSDMHCHIMESQKLVE
THLIDSGNQDEEIQELHKSKDCEESEVEVNNKLREKRPKLSEGMVGEETGISAGPNSIED
SNLNHGDRCTWEGEIEQSELQMTDKKAEQSRKLTTVSETQSKIVSDLSAQALSSTKAKID
SFPPEARSLLQNPQEKPVKVSAPELLLQSPARSDMCLTDSAQEQGVSTGNEEWLENSAPE
SSSRTSYRSLKLQRERSKDLQGKMIYELTVWDENNKSETWESPEKPETETLELQDVHPEL
TVTIESKALEDFAVTDLKVEELAALGNLGDMGVDFCNTRVDQAHRSPNALSQKVCEENSM
SPIGCNPSTLPDLEPIPSFSEFPLDSPKTLVLNFGAEGEQNSSNRRSGRITPNILKTGLP
IENVNLGLGSLEGTHQALDLLAGGMMPEEVEETSQLEKQDSLRLESETINPAGLGPSPCL
PDLVEFVTRTSGVQKEKICSPLSEPGDPPKCSSPETGPLQLEIPKVSITHLAIPQVDEDT
DHPLNLAKSLASGSPTREQIVGGNMVPQEITAQEASVAATQDHTESSVHD
Download sequence
Identical sequences ENSFCAP00000016953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]