SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017126 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017126
Domain Number 1 Region: 360-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000605
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 595-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000711
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 3 Region: 854-902
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000459
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000017126
Domain Number - Region: 633-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000663
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 160-170
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0157
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017126   Gene: ENSFCAG00000026866   Transcript: ENSFCAT00000031774
Sequence length 1103
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:73997355:74011434:-1 gene:ENSFCAG00000026866 transcript:ENSFCAT00000031774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQRKPQQLISDCEGPSASENGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDP
PVMVIIGGQENPNNSSTSSEPRAEGQTSPQVMEAEHNNPPDSGSSVPTDPTWGPERRVEE
PAGHFLVAATGTAAGGGGGLILASPKLGATPLPPESTPAPPPPPPPPPPPGAGSGHLNIP
LILEELRVLQQRQIHQMQMTEQICRQVLLLGSLGQTVGTPASPSELPGAGTASSTKPLLP
LFSPIKPVQTTKTLAPSSSSSSSSSSSHPLGSQHPFSAGGVGRSHKPAPAPSPALPGSTD
QLIASPHLAFPGTTGLLAAQCLGAARGLEAAASPGLLKPKNGSGELGYGEVMGPLEKPGG
RHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGNLKVHFHRHREKYPHVQ
MNPHPVPEHLDYVITSSGLPYGMSVPPEKAEEEVAVPGGGVERKPLVASTTALSATESLT
LLSTGAGTATAPALPAFNKFVLMKAVEPKSKADENTPPGSEGSAIAGVAESGTATRMQLS
KLVTSLPSWALLTNHFKSTGSFPFPYVLEPLGASPSETSKLQQLVEKIDRQGAVPNQCVI
CLRVLSCPRALRLHYGQHGGERPFKCKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPI
CQKKFTNAVTLQQHVRMHLGGQIPNGGTTLSEGGGAAPENGSEQSTVSGEEEDVTDEDSL
AGRGSESGGEKAISVRGDSEEASGAEEEVGTAAAAAATSGKEMDSSEKVIQQPSLPPPPP
PPDSLDQTRPMEQGGSDAAGGVEEGGKPERSSSPPSAHTREGEGGGGGGGTAAEELSTQE
AMRTEPGASSSRKACEVCGQTFPAQAALEEHQKTHPKEGPLFTCVFCRQSFLERAVLKKH
MLLAHHQVQPFAPHGPQNIAALSLAPGCSPSITSPGLSPFPRNPSVVHPPWLLSSPCFHI
PKGIPLQLPWGDPSPPSPFFLSLSLWQVHLSTHIWNCSPARRGRQLSLEGPVPLLSGDQV
NLQDFLSQDVPAQLVRVGPLSFWNQYTAFLSRDLPTQPRSSGSTSTTSLAMGSREAKEKR
APLFLFRSPASKAVPEKPIREEK
Download sequence
Identical sequences ENSFCAP00000017126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]