SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017213 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017213
Domain Number 1 Region: 102-198
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-19
Family PDZ domain 0.0000936
Further Details:      
 
Domain Number 2 Region: 189-288
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-17
Family PDZ domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017213   Gene: ENSFCAG00000022994   Transcript: ENSFCAT00000025829
Sequence length 292
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:30616994:30630839:1 gene:ENSFCAG00000022994 transcript:ENSFCAT00000025829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLYPSLEDLKMDQAIQAQARAAPRMPALPVSQPSVPFPSVLYPSLAELENYMGLSLSS
QEVQQNLLQIPEGASMVGSGPLLGQLVAPVSGNSQGARRAEIKPGMREIHLCKDERGKTG
LRLRAIDQGLFVQLVKANSPASLVGLRFGDQILQIDGCDCAGWSTDRAHRVLKRASAEKI
VMVVRDRPFQRTVTMHKDSTGHVGFVIKKGKVVSVVRGSSAARNGLLTNHSVCEVNGQNV
IGLKDKEVTEILATAGNVVTLTIIPTVIYDHMVKKLSPTLLHHTMDHSIPDA
Download sequence
Identical sequences ENSFCAP00000017213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]