SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017227 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017227
Domain Number 1 Region: 15-69
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000000000196
Family Formin homology 2 domain (FH2 domain) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017227   Gene: ENSFCAG00000027130   Transcript: ENSFCAT00000025508
Sequence length 72
Comment pep:novel chromosome:Felis_catus_6.2:F1:19439168:19441200:-1 gene:ENSFCAG00000027130 transcript:ENSFCAT00000025508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFPLVPKNVEASEEKKTLPAKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIKNIILEVN
EDMLSEALIQVT
Download sequence
Identical sequences ENSFCAP00000017227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]