SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017284 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017284
Domain Number 1 Region: 539-669
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-31
Family Synaptotagmin-like (S variant) 0.000000836
Further Details:      
 
Domain Number 2 Region: 1193-1313
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-23
Family Synaptotagmin-like (S variant) 0.0077
Further Details:      
 
Domain Number 3 Region: 371-493
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017284   Gene: ENSFCAG00000027891   Transcript: ENSFCAT00000029941
Sequence length 1342
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:48937143:49265483:1 gene:ENSFCAG00000027891 transcript:ENSFCAT00000029941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTRSPSVSRDQNRRYDQREEREEYSQYATSDNAMPRSPSDYADRRSQREPQFYEESDHIN
YRDSNRRSHRHSKEYIVDDEDVESRDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQ
MRIHAEVSRARHERRHSDVSLANAELEDSRISMLRMERPSRQRSISERRAAMENQRSYSM
ERTREAQGPSSYPQRTTNHSPPTPRRSPIPIDRPDMRRTDSLRKQHHLDPSSAVRKTKRE
KMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVE
IESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKKMMYFGGHSLEEDLEWSEPQIKDS
GVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKV
VGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRFLQGATFEEVYNIILESK
PEPQVELVVSRPIGDIPRIPDTTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQ
YLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKT
VKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDD
EPHWYKLQTHDVSSLPLPHPSPYMARRQLHGESPTRRLQRSKRISDSEVSDYDCDDGIGI
VSDYRHNGRDLQSSTLSVPEQVMSSNHCSPTGSPHRVDVIGRTRSWSPSVPPPQSWNVEQ
GLRGTRSAAGHYNTISRMDRHRVMDDHYSPDRDSQFLTLPRSRYSQTIEHHHRDGRDCEA
ADRQPYHRSRPTEQRPLLERTTARSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRSHPR
TGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERSAMDIDERNRQMKINKYKQVAGSDPRLE
QDYHSKYRSGWDPHRGADNISTKSSDSDVSDISAVSRTSSASRFSSTSYMSVQSERPRGN
KKISVFTSKMQSRQVGISGKNMTKSTSISGDMCSLEKNDGSQSDTAVGALGTGGKKRRSS
IGAKMVAIVGLSRKSRSASQLSQTEAGGKKLRSTVQRSTETGLAVEMRNWMTRQASREST
DGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKK
GQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSF
EESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLA
PLTRRASQSSLESSTGPSYSRS
Download sequence
Identical sequences ENSFCAP00000017284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]