SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017370 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017370
Domain Number 1 Region: 98-186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000273
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017370   Gene: ENSFCAG00000031592   Transcript: ENSFCAT00000030046
Sequence length 207
Comment pep:known_by_projection scaffold:Felis_catus_6.2:JH408686.1:690697:698441:1 gene:ENSFCAG00000031592 transcript:ENSFCAT00000030046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPEQYQEDAPD
IKDMSKFKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQVRKENSRDTASQAIK
Download sequence
Identical sequences M3WSN4
ENSFCAP00000017370 XP_004001167.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]