SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017470 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017470
Domain Number 1 Region: 50-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000437
Family LIM domain 0.0018
Further Details:      
 
Domain Number 2 Region: 18-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000121
Family LIM domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000017470
Domain Number - Region: 115-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000376
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017470   Gene: ENSFCAG00000027496   Transcript: ENSFCAT00000029028
Sequence length 151
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:89842458:89848584:-1 gene:ENSFCAG00000027496 transcript:ENSFCAT00000029028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLLSREPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEV
GRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQK
HFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Download sequence
Identical sequences A0A2K5Y399 F7AQI4
ENSFCAP00000017470 XP_001492641.2.31192 XP_008522890.1.77740 XP_009244762.1.23681 XP_011820937.1.47321 XP_014706557.1.49734 XP_016776144.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]