SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017514 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017514
Domain Number 1 Region: 99-205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000236
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000072
Family Spectrin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000017514
Domain Number - Region: 196-241
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017514   Gene: ENSFCAG00000026442   Transcript: ENSFCAT00000028103
Sequence length 243
Comment pep:novel chromosome:Felis_catus_6.2:X:27502184:27530850:-1 gene:ENSFCAG00000026442 transcript:ENSFCAT00000028103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVDVFLKDEWPALGDSEILKKQLKQCRLLVNDIQTIQPSLNSVNEGAQKIKNEAEPEF
ACRLETELRELNTQWDYVCRQVYARKEALKGGLDKTVSLQKDLSEMHEWMTQAEEEYLER
DFEYKTPDELQTAVEEMKRAKEEAQQKEAKVKLLTESVNSVIAEAPPAAREALQKELDTL
TTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVEFKLKTTENIPSGAEEIS
EVL
Download sequence
Identical sequences ENSFCAP00000017514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]