SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017539 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017539
Domain Number 1 Region: 442-678,738-811
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.02e-36
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.033
Further Details:      
 
Domain Number 2 Region: 60-191,223-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.02e-26
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017539   Gene: ENSFCAG00000001231   Transcript: ENSFCAT00000030440
Sequence length 857
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:33844806:33883510:1 gene:ENSFCAG00000001231 transcript:ENSFCAT00000030440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTASTAQQTVSAGAPLEGLQGGGPMDGQHSPSVHSFQTTARLLLSRCPATISVCFLPS
LLEYNCREEFQIHDELLKAHYTLGRLSEATPEHYLVQGRYFLVRDVVEKMDVLGTVQSCG
APNFRQVRGGLTVFGMGQPTLSGFRRVLQKLQEDGHRECVIFCVREEPVLFLRAGEDFVP
YTPRDKQNLRENLQGLGPGIQAESLELAIRKEIHDFAQLSEHTYHVYHNIEDLLGEPHAV
AIRGEDDVHVTEEVFKRPLFLQPTYRYHRLPLPEQGAPLEAQFDAFVSVLRETPSLLPLR
DAHGPPPALLFSCQTGVGRTNLGMTLGTLILFHHSRAASRPEAVPLQTKPLPMEQLQVIQ
SFLHMVPQGRKMVDEVDRAITACAEMHNLKEAILENQRKLESVRPAGPAQGSSSQHGVRQ
RALQSLERYFYLVLFNYYLHEQYPLAFALSFSRWLCAHPELYRLPVTLSSAGPVVPGDLL
TKGSLGADDLISPDALSTVREMDVANFRRVPRMPIYGTAQPSAKALGSILAYLTDAKRKL
KHVVWVNLREEAVLECDGHTHSLRWPGPPMAPDQLEHLEIQLKAHLSTPLPGTGGPPTHR
FQTCLTTREVFAQHRGAYPGLTYHRIPVPDFCAPCEEDFDRLLEALRAALAKDAGTGFVF
SCLSGQGRTTTAMVVAVLAFWHIQGFPEVGEEELVSVPDAKFTKGEFEVVMKVVQLLPAG
HQVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKSEPEARRLQLRSLQYLERYV
YLVLLNAYLHLEKADSWQRPFSAWMREVASKAGVYEILNQLGFPELESVQDQPFSGLRCR
WQERSHGLEPAAAGDFL
Download sequence
Identical sequences ENSFCAP00000017539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]