SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017651 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000017651
Domain Number - Region: 787-794,875-901
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00157
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017651   Gene: ENSFCAG00000025959   Transcript: ENSFCAT00000026967
Sequence length 960
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:143633941:143735638:1 gene:ENSFCAG00000025959 transcript:ENSFCAT00000026967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFALEETLESDWVAVRPXRTAQRQRSGSREQAGARGGAEPGAPTSDGTRGPGSPAGKGR
PEATASAILGRSPGPRRSPAWAEGGSPRSARSLRGDPLLRSPAGKGAESPLRSPVRAQTS
PVRRGSEGRDVAGAAPSAPPEAPMSSVRVVSACGAVSEEIEVLEMVREDEVAPGALALSD
AEQPPPTAELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEQCLPVFPEEPSGMWTVL
FGGAPEMTEQEIDTLCYQLQVYLGHGLDTCGWKILSQVLFTETDDPEEYYESLSELRQKG
YEEVLQRARKRIQELLDKHKNTESMVELLDLYQMEDEAYSSLAEATTELYQYLLQPFRDM
RELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKA
QKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETLQMMRAKEICLEQRKHALKEEM
QSLQGGTEAIARLDQLEADYYDLQLQLYEVQFEILKCEELLLTAQLESIKRLISAEKRDE
VVYYDTYESMEAMLEKEEMAVSVHLQREELQKLQQKARQLEARRGRVSAKKAYLRNKKEI
CIAKHNEKFQQRLRSEDEYRAHHTVQLKREKLHDEEERKSAWVSQERQRTLDRLRTFKQR
YPGQVILKSTRLRLAHARRRSTASPVPCEDQCDSLPGALQVEEKSAKAEEGIGELGSSHK
TEAQSLAHLEDTSLAQLEAASLPLSGVTSELPPTVSLPLLNNTDLEPGSVTTDPLPPPLP
PTPPPPPPPPPPPPPPPLPVAKDTSPETLEKGLPRTEANEKRIPKSASAPSAHLFDSSQL
VSARKKLKKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQ
IRKGVKLKKVQKEVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEALPCTDWEN
Download sequence
Identical sequences ENSFCAP00000017651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]