SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017860 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017860
Domain Number 1 Region: 75-127
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000314
Family Elafin-like 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000017860
Domain Number - Region: 32-75
Classification Level Classification E-value
Superfamily Elafin-like 0.000222
Family Elafin-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017860   Gene: ENSFCAG00000022718   Transcript: ENSFCAT00000027626
Sequence length 134
Comment pep:novel chromosome:Felis_catus_6.2:A2:62693390:62694764:-1 gene:ENSFCAG00000022718 transcript:ENSFCAT00000027626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLASLALVLLALEAAVALAAAPAFTVPGQAMCPELSSSEEDSCVVSCSTDDDCPQGIR
CCPRSPCSRSCVFPVMAPLQKAGRCPRVPVPLAPKPCSESTECSVDSQCAGSRKCCFSTC
AMRCLDPATEDPLQ
Download sequence
Identical sequences ENSFCAP00000017860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]