SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018011 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018011
Domain Number 1 Region: 1697-1999
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000314
Further Details:      
 
Domain Number 2 Region: 37-299
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.81e-75
Family Carbonic anhydrase 0.00000894
Further Details:      
 
Domain Number 3 Region: 1997-2282
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.89e-73
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000147
Further Details:      
 
Domain Number 4 Region: 309-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000102
Family Fibronectin type III 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018011   Gene: ENSFCAG00000015760   Transcript: ENSFCAT00000026283
Sequence length 2315
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:139473228:139657065:1 gene:ENSFCAG00000015760 transcript:ENSFCAT00000026283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILKRFLACIQLLCVCRLDWAYGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCSSPK
QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYWLSGGVSEMV
FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYGFDADRFSSFEEAVKGKGKLRALS
ILFEIGTEENLDYKAIIDGVERVSRFGKQSALDPFILLNLLPNSTDKYYTYNGSLTSPPC
TDTVDWIIFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHETVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLEGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLHGKYSDQLIVDMPSDDPELDLFPE
LIGTEEIVKEEEEGKDTEEDTVVNPGRDSATNQIRRKEPRIPTTTNYNRVGTKYNEAKTN
RSPTRGSEFSGKGDIPNTSLDSTSQPVTGSAPQKHFSLTSQTVTKMPPHTLEGASASLNE
SSKTILRFLQKNLTGTVESLNTVSITEEESLLTSFKFDTGADDSSGSSPATSAMPFISEK
ISHGFVFSSENPETITYRVLLPESTRNASEDSASSGSEESLKDPSIDGNVWFASTPDVIT
QPDVGSGRESFLQTNYAKIHVDESEKTAESSSPGPLVSQGPPGTDLEMPPYSTFAYFPTE
VTPHAFTPSSGQQDSVPTVNMVHSQTTQPVYNGETPLQPFYSSEVFPLVTPLLLDNQILN
TTPAASSSDSALHATPVFPGVDVSFESILSSYDGAPLLPFSSASFSSESFRHLYTVSQIL
PQVTSAVESDKLSLHASLPVAGGDVLLEPSLAQYSDVMLHQTTAHAASETLGFGGSESGV
LYKTHMFSQVEPPSSDVVMHARSSGPEPSYALSNNEGSQHFFTVPYSSAVPVHGPVGVSH
QASLFSSPSHIPVPESSFIIPTASLLLPPHGLSGDGEWSGASSDSEFLLPDTDGLTALNI
SSPVSVAEFTYTASVFGDDNKPLSKSDILYGNETELQISSFSEMVYHSESTVMPGLYDEI
NKSNVSLQESPVSFSSTEGIFPGSLAHPATEVFDQEISHVPENNFSVQPTRAVSQAFGDT
SLKPVRRASSEPASSDPASSEMLPPSTQLLYEPSASFNTEMLLQPSFQASDVDTLLKTAL
PPVPSDPLLVETPKVEQISSTVLHLMASNSASRENMLHSTSAPVVDVSPTSNVHAASLQG
LTISYASEKYSEPVLLKSESSQQVVPSLYSNDELFQTTNLEVSHAFPPKGRHAFATPVLS
IDVPPNTLTDKPLYSDEVFTSTKGSLTDEVFAGIPAVSDTLVTADGSVPLGNAYVSITAV
SPNKDGSVTTTKFLFPSETTSELIQSARSDGDLVGGGDDGDLDDYDDDYDDRDRDGLSIN
KCMACSSYRESEEKVMNDSDTQDNNLVDQTNPTSYSLSENSKEENKVTGVISDSQTDTDR
SPDKSPPTNVLPPNPSDGRQENDIQTGNALLPFTPESEAWVLVAGDEESGSGQAVSDNLN
DNETSTDFSFPDVNERDVDGVLEAADSEITPGSPQSSTPTVTSRHSEVFNISEAEASNSS
HESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR
VISTPPTPVFPTSDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQGCTADLGI
TADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAA
QGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGSFLVTQKSVQ
MLSYYTVRSFTVRNTKIKKGSQKGRPNGRVVTQYHYTQWPDMGVPEYSLPVLAFVRKASH
AKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQQEGTVNIFGFLKHIRSQRNYLVQTEE
QYVFIHDALVEAILSKETEVPDSHIHAYVNALLIPGPTGKTKLEKQFKLLSQSNIQQSDY
STALKHCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL
HTIKDFWRMIWDHNAQLVVMLPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLS
NEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPVI
VHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFADIEQYQFLYKAVL
SLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences ENSFCAP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]