SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018071 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018071
Domain Number 1 Region: 123-506
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.52e-122
Family Myotubularin-like phosphatases 0.000000252
Further Details:      
 
Domain Number 2 Region: 16-115
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000529
Family GRAM domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018071   Gene: ENSFCAG00000030638   Transcript: ENSFCAT00000022467
Sequence length 543
Comment pep:novel chromosome:Felis_catus_6.2:C1:23536780:23566260:-1 gene:ENSFCAG00000030638 transcript:ENSFCAT00000022467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFSDLIRTGRAQAKLLRGPEAPPLRGTLCLTGHHLLLSPGPQATSELWLLLLRSVDSIE
KRVASDSGTITLRCKDLRVLQLEIEGVEASLDIARSIEALSSLESVITSFPFFYRPKGLR
LGDAWHFHPPERYYKRVARETNAWRLSEVNEDFSVCPSYPRAVIVPRSVDDGALARSARF
RQGGRFPVLSYHHAPSGTVLVRSSQPLTGPQKRRCAEDEELLRAVLLGARPGARGFIVDT
RSSQAAKQARMTGGGTEAKAAYPGWKRLHRPLERGQPLQESFVRLVEACGDLQQSTDSWL
RRLEGCCWLAHVKEALSTACLAAQGMEREGACILVHGAEGTDSTLLVTSLAQLILDPLSR
TMAGFQELVEREWIQAGHPFQLRCAHSAFSHARSKHEAPTFLLFLDCVWQLGRQFPLSLE
FGEGLLLALFEHAYASPFGTFLCNSEKERCLCEVRTRTHSLWSGLNQPKERRKLRNPLYA
PNPLAIWPSVELQSLRLWQGLFLRWICPPEPSEVAWEKVWQIMTDKEKTKLSQPTVSASE
PQL
Download sequence
Identical sequences A0A2I2UPB3
ENSFCAP00000018071 XP_006934596.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]