SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018073 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018073
Domain Number 1 Region: 612-781,818-943,1028-1078,1143-1212,1269-1409,1446-1488
Classification Level Classification E-value
Superfamily ARM repeat 0.00000211
Family Armadillo repeat 0.083
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000018073
Domain Number - Region: 139-149
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 445-561,670-716
Classification Level Classification E-value
Superfamily ARM repeat 0.0714
Family HspBP1 domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018073   Gene: ENSFCAG00000024620   Transcript: ENSFCAT00000028564
Sequence length 1812
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:40681514:40740317:-1 gene:ENSFCAG00000024620 transcript:ENSFCAT00000028564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYG
ETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCL
TLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPSLKRNPKHADGEKEDQFNGSPPRPQPR
GPRTPPGPPPPDDDEDDPIPLPVSGDKEEDASHREDYFEPISPDRNSVPQEGQYSDEGEV
EEEQQEEGEDDEDDVDVEEEEDEDEDDRHTVDSIPEEEEEDEEEEGEEDEEGEGDDGYEQ
ISSDEDGIADLERETFKYPNFDVEYTAEDLASVPPMTYDPYDRELVPLLYFSCPYKTTFE
IEISRMKDQGPDKENSGAVEASVKLTELLDLYREDRGAKWVTALEEIPSLIIKGLSYLQL
KNTKQDSLDQLVDWTMQALNLQVALRQPIALNVRQLKAGTKLVSSLAECGAQGVMGLLQA
GVINGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRGRQNEKSGYQKLLELILL
DQTVRVVTAGSAILQKCHFYEILSEIKRLGDHLAEKTSSVPNHGEPDHDTDAGLERTNPE
YENEVEASMDMDLLESSNISEGEIEKLINLLEEVFHLMETAPHTMIQPPVKSFPTMARIT
GPPERDDPYPVLFRYLHSHHFLELVTLLLSIPVTSAHPGVLQATKDVLKFLAQSQKGLLF
FMSEYEATNLLIRALCHLYDQDEEEGLQSDGVIDDAFALWLQDSTQTLQCITELFSHFQR
CTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLEKNLQSLITLMEYYSKEALGDS
KSKKSVAYNYACILILVVVQSSSDVQMLEQHAASLLKLCKADENNAKLQELGKWLEPLKN
LRFEINCIPNLIEYVKQNIDNLMTPEGVGLTTALRVLCNVACPPPPVEGQQKDLKWNLAV
IQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMGTTLHRVTTISMARCTLTLLKTMLTEL
LRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLT
ISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVA
LNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHMLRRICVQLCDLASPTALLIMRTVL
DLIVEDLQSTSEDKEKQYTSQTTRLLALLDALASHKACKLAILHLINGTIKGDERYAEIF
QDLLALVRSPGDSVIRQQCVEYITSILQSLCDQDIALILPNSSEGSISELEQLSNSLPNK
ELMASICDCLLAMLANSESSYSCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSNALHSLLK
RVVSTFSKDTGELASSFLEFMRQILNSDTMGCCGDDSGLMEVEGTHPSRTMSINAAELKQ
LLQSKEESPENLFLELEKLVLEHSKDDDNLDSLLDNVVGLKQMLESSGDPLPLGDQDIEP
VLSAPESLQNLFNNRTAYVLADVMDDQLKSMWFTPFQAEEIDTDLDLVKVDLIELSEKCC
SDFDLHSELERSFLSEPSSPGRTKTTKGFKLGKHKHETFITSSGKSEYIEPAKRAHVVPP
PRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFVAAESKEVVPQDGIPPPKRPLKV
SQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKGNYSRREGTRGSSWSAQNTPRGTYNES
RGGQSNFNRGPLPPLRPLSSTGYRPSPRDRASRGRGGLGPSWASANSGSGGSRGKFVSGG
SGRGRHVRSFTR
Download sequence
Identical sequences A0A2I2UHJ3
ENSFCAP00000018073 XP_004000027.2.62641 XP_007095632.1.5354 XP_019309031.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]