SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018074 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018074
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-39
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-36
Family Second domain of FERM 0.0000673
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018074   Gene: ENSFCAG00000022135   Transcript: ENSFCAT00000027420
Sequence length 732
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:118391927:118524103:-1 gene:ENSFCAG00000022135 transcript:ENSFCAT00000027420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFFRRTLGRRSMRKHAEKERLREAQRASTHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKASTAKPEEFSVHNNVSTQSNGSQQAWAVKSTLPVVPS
VPSGPVLAEIENLPRNPGTDQHDRKCLPLNIDLLDSPDLMETTIDDLIGAPDTLETPQVP
DEVNTVTGQTGLEEPKEECETLKDASEKLRHLELESSLLPSSRPSVDVNINNQEEVVKLT
EKCLNNAIESPGLNARRVPPDLKSNILKAQVEAVHKVTREDSLLSHKNAHAQDAATNSAV
LNENNVPLPEDSLAVMHTTPAANGSVLKDATDELDALLLSLTENLIDHTITPQVSSTSMI
TPRWIVPQSRVLSDGLAGSVPSLAGKEGHGNREAASLISAPAPFLVDAVTSSVPTLAEEA
ILKQKCLLTTEL
Download sequence
Identical sequences M3WUN7
ENSFCAP00000018074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]