SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018178 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018178
Domain Number 1 Region: 681-980
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000105
Further Details:      
 
Domain Number 2 Region: 10-153
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-31
Family Third domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018178   Gene: ENSFCAG00000023866   Transcript: ENSFCAT00000022974
Sequence length 984
Comment pep:novel chromosome:Felis_catus_6.2:F1:28824835:28864330:1 gene:ENSFCAG00000023866 transcript:ENSFCAT00000022974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYINEVERLDGFGQEIFPVKDNHGNSVQLGIFFMGIFVRNRIGRQAVIHRWNDIGNITHN
KSTILVELINKEETALFHTDDLENAKYISRLFATRHKFYKQNKICTEQSNSPPPIRRQPT
WSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFHGNEEALYCNSHNSLDLNYLNGTV
TNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDIMRADYIPSHRHSAIIVPSYRPTP
DYETVMRQMKRGTVHADSQSQSLRNLSIINTHAYNQPEDLVYSQPEMRERPPYAVPYGPQ
GGYGNKLVSPSDQMNPKNNMVPSKPGASSISHTVSTPELANMQLQGTQNYNAAHMLKNYL
FRPPPPYPRPRPATSTPDLASHRHRYVSGSSPDLVTRKVQLSVKTFQEDSSPVVHQSLQE
VSEPLTATKHHGTANKRHSLEVMSSMVRGMEAMTLKSLNIPMARRNTLREQGPPEEVPGS
HEAHQLPHYHHKKTLSDATMLIHSSESEEEEEEAPGSVPQIPMLREKMGYSAQLQAALAR
IPNKPPPEYPGPRKSVSNGALRQDQVSLPPAAARARVLRHGPAKAISVSRADQLAVAGPS
LGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSIVEREMAIRNLEKQKMASLEAQKR
PLMLAALNGLSVARVSGREESRADATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANG
IFSTAALPENAERSRIREVVPYEENRVELVPTKENNTGYINASHIKVVVGGAEWHYIATQ
GPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTK
FRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHT
NSMLEGAKNRHPPIIVHCSAGVGRTGVVILSELMIYCLEHNEKVDVPIMLRLLREQRMFM
IQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences ENSFCAP00000018178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]