SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018299 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018299
Domain Number 1 Region: 520-650
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-38
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 183-282
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-17
Family PDZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 6-60
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000436
Family SAM (sterile alpha motif) domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018299   Gene: ENSFCAG00000026807   Transcript: ENSFCAT00000026381
Sequence length 1014
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:17175933:17401205:1 gene:ENSFCAG00000026807 transcript:ENSFCAT00000026381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAVDLLCALLLQNH
MLELTNLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSL
LAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHI
ISLSSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHA
GDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLAL
QPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGH
MVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKGRSSSQGRRESTPTYGKLR
PISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKKDTGKKSKK
KSDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQSSLQHKSKKKNKGPIAGK
SKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLYWYINEEDEKAEGFI
SLPEFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLTAGYAERERIK
QEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQS
QSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSA
AISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGGKPRSFTLPRDSGFNHCCL
NAPVSACDPQDDVQPTEVEEEEEEEEEEEAGENIGDKSESREEKLGDSLQDLYRALEQAS
LSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPD
LTSKEFQQWKQMYLDLFLDICQNTTPNDPLSISSEVDVITSSLAHTHSYIETHV
Download sequence
Identical sequences ENSFCAP00000018299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]