SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018332 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018332
Domain Number 1 Region: 37-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-36
Family SCAN domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 159-218
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-19
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018332   Gene: ENSFCAG00000022036   Transcript: ENSFCAT00000031036
Sequence length 342
Comment pep:novel chromosome:Felis_catus_6.2:E1:9225218:9239142:1 gene:ENSFCAG00000022036 transcript:ENSFCAT00000031036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSSRSQILLMWKPDKVQSGPHNVEKETHALRLLRDTETCRQNFRNFPYPDIAGPRKAL
NQLRELCLKWLRPEIRSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEVVTLVEDL
TQILEEEAAPQHSALPQETPEEDPKGRPAFQAGWLNDLVTKESMTFKDVAVDITQEDWEI
MRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPMLEEPWMVIKEILEGPSPEWKTEAQE
CTPVTDTSKFTKTGTQTIKMEEPYDYDDRLERQAADTFRKIPTSGRNSPLKSVLSQEDDP
MEECLSKYDIYRNSFEKHSNLIIQFGTQSDNKLFKFNVKFKK
Download sequence
Identical sequences ENSFCAP00000018332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]