SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018419 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018419
Domain Number 1 Region: 821-826,887-1264
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 7.06e-84
Family Formin homology 2 domain (FH2 domain) 0.0000845
Further Details:      
 
Domain Number 2 Region: 2-162
Classification Level Classification E-value
Superfamily ARM repeat 2.5e-21
Family Diap1 N-terninal region-like 0.049
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000018419
Domain Number - Region: 818-880
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018419   Gene: ENSFCAG00000008802   Transcript: ENSFCAT00000024819
Sequence length 1413
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:58955374:59218553:1 gene:ENSFCAG00000008802 transcript:ENSFCAT00000024819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQIMLYVDGMNGVINHNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYSESNAPLLIQA
VSAVDTKRGVTPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDSFYDVVDCLEE
LGIAAVSQRHLNKKGTDLDLVEQLNMYEVALRHEDGDETAEPPPSGRRDRRRASVCSGGG
SGEGEQRGLDRRRSRRHSVQSIRSPVSAPTSPSSQSAPGFKPGQVREHCEKEEEEEEEEE
QPVTEPNSEEEREDDAPCQGKDREARPASDQSPTGKDAAPQSSALPTASNAASQGKRCPA
STAVGGPLRSRSSGPALVLPPLTPASASRPSSSAPGPPKASPTIEKLPYVPHSPFHLFSY
DFEDSPLPTKEKEAEAQKESRYNSFGNTSYHSRPSGSAVPATPTSSLSPPQEARLERSSL
SGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNKFNREYLDKREEQRQAREERY
KYLEQLAAEAHEREVRSRSASRGRGDLSLDLTSPAAPASPTPLSHSSPSLDSQEALAASS
SSLGTSQHPQASAGDPEPGPEAEVGQSADEASPEVAPARVGAESEAERALEQEPEERASL
SEKERQSEEVNEKDNCSASSISSSSSTLEREEKEDKLSRDRGPGLWSAGVQDAGVNEQCG
DILTNKRFMLDMLYAHNRKPTDDKEKGEGETGRTEPGAEAVASLASRISTLQANSLAQDD
SVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDAEPNDKVPEKASAQQKTESDYIWD
QLMANPRELRIQDMDFTDLGEEDDVDVLDVDLGPREAPGPPPPPPPTFLGLPPPPPPPLL
DSVPPPPVPGNLLAPPPPVFNAPQGLGWPQVPRGQPAFTKKKKTIRLFWNEVRPFEWPCK
NNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEVIVLDPKRSNAI
NIGLTVLPPPRTIKIAILNFDEYALNKEGIEKILTMIPTEEEKQKIQEAQLANPDVPLGS
AEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILST
LLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGA
VTRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLKQRMSEFLKDCAERIIIL
KIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRILSEFALEYRTTRERVLQQKQKRAN
HRERNKTRGKMITDSGKFSSSSPAPLSQPQGLSYAEDATEHENMKAVLKTSSPAVEDATP
VLGVRTRSRASRGSASSWTMGTDDSPNVTDDAADEIMDRIVKSATQVPSQRVVPRERKRS
RANRKSLRRTLKSGLTPEEARALGLVGTAELQL
Download sequence
Identical sequences ENSFCAP00000018419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]