SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018428 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018428
Domain Number 1 Region: 1745-1785,1822-2017
Classification Level Classification E-value
Superfamily Plakin repeat 4.97e-66
Family Plakin repeat 0.00000973
Further Details:      
 
Domain Number 2 Region: 1649-1773
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000149
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 198-307
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000134
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 718-829,857-884
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000268
Family Spectrin repeat 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000018428
Domain Number - Region: 591-702
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000689
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 155-200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018428   Gene: ENSFCAG00000029136   Transcript: ENSFCAT00000030241
Sequence length 2040
Comment pep:novel chromosome:Felis_catus_6.2:E1:57537958:57555205:-1 gene:ENSFCAG00000029136 transcript:ENSFCAT00000030241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKGLNKGSQGKGSPKGSPAKGSPKGSPSKHSRAATQELALLISRMQANADQVERDILET
QKKLQQDRVHGEQDQALKHRQEVGRSLKEAEVLLKDLFLDVDKARRLKHPQAEEIEKDIK
QLHERVTQACAEYRALYEKMVLLPAVGPRVDWARVLEQKQKQVREGRYGPGMAQLEEQIA
EHNILQKEIEAYGQQLRNLIGQDAATIRSQYRDLLKAASWRGQSLGSLYTHLQGCTRQLN
ALAQQQQDILQQDWSDLMADPEGVRREYEHFKEHELLSQEQSVNQLEDDGERMVELGHPA
VGPIQFERDISQRGFPSFLKMFSCITAIPLSHGQEFHSITQLQDEEADSVSQTLAKLNSS
LDTQYSPAPGGPPGAPTELLQQLEAEKKQLAVAEKTVGDLQRRSHQVAPLQQRRNPPQQP
LHVDSICDWDSEEVQLLRGERYVLMDNTDQHTWVVQGPGGETKRAPAACFCIPAPDPEAV
ARASKLASELQALKQKLATVQSHLTASTTQPLQTGQQAPAGPAPEDPQAQKLLTQMTRLD
GDLGQIERQVLAWARAPLSRTAPLEDLEGRIQSHKGTAQRLQSLGAEKEAAQQECEAFLS
GQPVGPVALHLPVVLNSVKNKYSDVQVLCNLYGEKARAALGLERQIQDTERVIRGLESSV
AQEAPLPASPGALQERVSELQSLRRELLEQQACVLGLHRELKATEHACSTLQNSFREFCQ
DLPHQQRQARALTDRYHAVGDQLDLREKMLQDASLTYQQFKNCRDNLSFWLEHLPHNQVR
PSDGPSQVAYKLQAQKRLQQEIQGREQDRAMASRLSQDLQAALQDYALQADTYRCSLETT
QAGSAPKRPRVAPLQESIQAQEKNLTKAYTEVAAACQQQLRQLEFARRMLEKKELSEDIQ
VTHDARQGSEGPARAGKDSEALKSQLEEERKRVAQAQHELEEQRNRLLQLRTQRPLERLE
EKEVVEFYRDPQLESDLSRVKSQVEDEGKKRASLQADLEAVAQQVVQLESKRRAMQPHLL
TKEVTQIERDPDLDSQAAQLGREIQHLRGQNATVSVRLEELKKELLALEKKEPNVKEKVV
VKEVVKVEKDLEVLKAAQALRLQLEEDTVRRKGAEEAVAKLRARLEELERAIGAVEPKVI
VKEVKKVERDPGLLEEAARLRSLLEETRSENATLARELEELRGRHGAAEKRKPKVELQER
VHETFQVAPETQQEMARLRAQLQETAGERSRVEQEVAALLPDLAALRAQKPAVEYKEVTQ
EVVKHERSPEVLREIDHLKAQLNELVNGSGRAQEQLIRLRGERDEWKRERSKVETKTVNK
EVVRHEKDPVLEKEAERLRQEVREAAQKRRAAEDAVSELQSKYLLLERRRPEEKVVVQEV
VVTRKDPKLREDHSRLSRSLDEEAGRRRQLEREVQQLQAGVQEKEGLLGFQEDRGKKLAA
ERELRRLTLKIRELEERPPVPQEKIIMEEVVKLEKDPDLEKSTEALRQDLDQEKARVTGL
HRECKNLRVQIDVLQTTKAQEKTIYKEVIRVEKDRVLEGERSRAWEALSRERSARQSREE
EVRQLRERIDKAEALRKTRAREEAELQKGRDQAARERRQLQQELRELEKQKQQTVLHLQE
EAQLLSRRTESERQKAAQRGQELSQLEAAILREKDQIHEKERTLRDLHAKVSREELNQET
QTRETNLSTKISILEPETGKDMSPYEAYKRGIIDRGQYLQLQELECDWEEVTTSGPCGEE
SVLLDRKSGKQYSIEAALRCRRISKEEYHLYKDGRLPISEFALLVAGETKPCSSLSIGSI
ISKSPLASPAPQGTGFFSPSLSLGLGDDSFPIAGIYDTTTDNKCTIKTAVAKNMLDPITG
QKLLEAQAATGGIIDLLSRERYSVHKAMERGLIENTSTQRLLNAQKAFTGIEDPVTKKRL
SVGEAVQKGWMPRESVLPHLQVQHLTGGLIDPKRTGRIPVPQAVLSGMISEELAQLLQDE
SGYEKDLTDPISKERMSYKEAMGRCRRDPLSGLLLLPAALEGYRCYRAASPSVLRSLPLR
Download sequence
Identical sequences ENSFCAP00000018428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]