SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018572 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018572
Domain Number 1 Region: 103-401
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.07e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018572   Gene: ENSFCAG00000023187   Transcript: ENSFCAT00000031720
Sequence length 404
Comment pep:novel chromosome:Felis_catus_6.2:D2:48300529:48395627:-1 gene:ENSFCAG00000023187 transcript:ENSFCAT00000031720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEDSNWKDVISWESLPSSSQTPRSVTREVLAKEDSSEEVKFSPQSSQNDYEDILKDAT
ESDSDPSIWATSGFLRDKWSSEDEELAGPSQTVPPQLHGIQIVSERELAQLAHVRPLIFS
FREQLTIKDCFNVLEKKVAEFEILQEFMTLDFQNLPGEFNSGNDLRNRDKNRYRDVLPYD
STRVPLGENKDYINASYIRIMNSGEEYFYIAAQGPLPSTTDDFWQMVLENNSNVIVMITK
EIEGGVVKCHHYWPISMKKPLELKNCRVFMENYQILQCFIIRIFQVVRKSTGTSHFIKHL
QFTNWPDHGTPAPVDGFIKYVRYVRKSHLTGPVLVHCSAGVGRTGVFLCVDVVFCAIEKN
FPFNIKNIVAQMREQRSGMIQTKEQYCFCYKVVLEVLQKILTFD
Download sequence
Identical sequences ENSFCAP00000018572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]