SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018691 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018691
Domain Number 1 Region: 50-167
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.63e-35
Family Multidomain sulfurtransferase (rhodanese) 0.00000802
Further Details:      
 
Domain Number 2 Region: 8-45
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000878
Family Multidomain sulfurtransferase (rhodanese) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018691   Gene: ENSFCAG00000030383   Transcript: ENSFCAT00000030467
Sequence length 181
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:133167403:133173191:1 gene:ENSFCAG00000030383 transcript:ENSFCAT00000030467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXTVSLLDGGLRHWLRLGLPLSSGKSRPAPAEFRASLDPAFVKTYEDVKENLESR
RFQVVDARAAGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLTQEGLEKSPEEICRLFQDK
KVDLSQPLVATCGSGVTACHVALGAYVCGKPDVAIYDGSWVEWYMRAQPEDVISEGRGKT
H
Download sequence
Identical sequences ENSFCAP00000018691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]