SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018760 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018760
Domain Number 1 Region: 14-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-45
Family G proteins 0.0000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018760   Gene: ENSFCAG00000023205   Transcript: ENSFCAT00000023121
Sequence length 186
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:45619812:45661113:1 gene:ENSFCAG00000023205 transcript:ENSFCAT00000023121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLDRLSGLLGLRKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKS
SSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKH
RRIPILFFANKMDLRDSVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQ
IQAVKT
Download sequence
Identical sequences M3XE96
XP_003991603.1.62641 XP_007095992.1.5354 XP_014936322.1.86478 XP_019303661.1.44245 ENSFCAP00000018760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]