SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018802 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018802
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-62
Family Dual specificity phosphatase-like 0.00000000515
Further Details:      
 
Domain Number 2 Region: 225-299
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.00000000335
Family mRNA capping enzyme 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018802   Gene: ENSFCAG00000030695   Transcript: ENSFCAT00000022560
Sequence length 299
Comment pep:novel chromosome:Felis_catus_6.2:B2:82062518:82106450:-1 gene:ENSFCAG00000030695 transcript:ENSFCAT00000022560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVK
MGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPE
LIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKG
VTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLEQKPYKVSWKADGTR
Download sequence
Identical sequences ENSFCAP00000018802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]